SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|219852844|ref|YP_002467276.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219852844|ref|YP_002467276.1|
Domain Number 1 Region: 124-253
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 3.35e-30
Family MJ1460-like 0.013
Further Details:      
 
Domain Number 2 Region: 32-97
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000165
Family MarR-like transcriptional regulators 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|219852844|ref|YP_002467276.1|
Sequence length 259
Comment MarR family transcriptional regulator [Methanosphaerula palustris E1-9c]
Sequence
MSVKKQGEEGHTLAVALFSTEEGVRTVGGMIQMRILAMLKEEDLSFDQIVSRSGRAKSTV
SVHLKGLVEGGVLTVRTDPVDRRKKIFSLASRHLGDLSSGDLHRSDLSTYLMGYAGADAP
PPDFFRLLFQTLRVTLLADGINIDPLLFSSGLHVGEAIAPTVAGPDLATLLGNLAHFWEK
HRLGRVEVISLDPITLYVYDCFECGDLPNIGRPACAFDAGLLSAVFSDYYHQTITAQETA
CYAMGDDHCCFVVPVPEIT
Download sequence
Identical sequences B8GE52
521011.Mpal_2264 gi|219852844|ref|YP_002467276.1| WP_012618872.1.75456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]