SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|219852895|ref|YP_002467327.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219852895|ref|YP_002467327.1|
Domain Number 1 Region: 126-395
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 9.02e-105
Family BC ATP-binding domain-like 0.00000015
Further Details:      
 
Domain Number 2 Region: 656-915
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 2.65e-104
Family BC ATP-binding domain-like 0.000000289
Further Details:      
 
Domain Number 3 Region: 1-124
Classification Level Classification E-value
Superfamily PreATP-grasp domain 2.45e-43
Family BC N-terminal domain-like 0.00000876
Further Details:      
 
Domain Number 4 Region: 533-658
Classification Level Classification E-value
Superfamily PreATP-grasp domain 3.6e-42
Family BC N-terminal domain-like 0.0000137
Further Details:      
 
Domain Number 5 Region: 391-529
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, large subunit connection domain 5.1e-36
Family Carbamoyl phosphate synthetase, large subunit connection domain 0.00031
Further Details:      
 
Domain Number 6 Region: 919-1044
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 2.09e-32
Family Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|219852895|ref|YP_002467327.1|
Sequence length 1056
Comment carbamoyl phosphate synthase large subunit [Methanosphaerula palustris E1-9c]
Sequence
MPRRTDIKKVLLIGSGPIQIGQAAEFDFSGSQACKSLREEGIEVVLVNSNPATIQTDPET
ADTIYIEPLRASIIAKIIEKEKPDGILSGMGGQTGLNLTAELAELGALRNVEILGTPLEA
IYQGEDREKFKALMQKIGEPVPRSMILNRLDQLGEVIEKVGLPVIIRPAYTLGGAGGGIA
HTVDELKRIVEIGLQRSRIHQVLIEESVMGWKELEFEVMRDAKDTCVIICSMENVDPMGV
HTGESVVVAPILTLRDDEYQMMRSASIKIIRALDVQGGCNIQFAFQDGDYRVIEVNPRVS
RSSALASKATGYPIARVAAKIAIGMHLDEITNAVTGCTPASFEPSIDYVVVKVPRWPFDK
FTRADRTLTTAMKSTGEVMAIGRTLEEGFKKALRSIDTDINTHTNHNEIRMILTSPTDER
FGCIFDAFREGFTVDEIASLTSINPFFLHKMENIVKIERTLATEPTDLRIQEAAAAGFSM
KEIAELTGRPVDEVRTAAGDPVYKMVDTCAAEFPATTPYYYSTHGVTTDIIQNDKKKVLI
LGSGPIRIGQGIEFDYCTVHAVKALREEGVEVHIVNNNPETVSTDFDTSDQLFFEPMQLE
DVVNILKTDDYFGVMVQFGGQNAVNLALPLLQEIKKLGLPTAILGSSPDAMDIAEDRDRF
SELLDALKIPSPPNSSAYSEEAALAMANKIGFPVLVRPSYVLGGRAMEIVHDNFELESYM
KEAMRVSKSHPVLIDSFLQEAIELDVDAVCDGDEVLIGGIMEHIEEAGVHSGDSACVIPT
QSLSDSVLARVREYTKKIAMGLGVVGLVNIQLAVKDDIVYVLEANPRASRTVPFVSKATG
IPLAKVAAKVMIGKKLKDLGYKERTFRHVAVKEVLLPFNKLPGVDTVLGPEMKSTGEVMG
IDYDFGRAYYKACISADNELPIEGNVFISVSTEQKEEVRRIAAQLRDLGLTLFGTKGTVE
TLMQAGIEANLVRKVQEGSPNVIDMVRKGEIRLIINTPVDKQSRLDHYQIMRAAVDYGIP
YITTLQAARAAALAIDAIKREKITLEPISHYLSEVE
Download sequence
Identical sequences B8GEA3
521011.Mpal_2319 gi|219852895|ref|YP_002467327.1| WP_012618923.1.75456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]