SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|219852925|ref|YP_002467357.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219852925|ref|YP_002467357.1|
Domain Number 1 Region: 205-496
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 4.61e-113
Family AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC 0.00000397
Further Details:      
 
Domain Number 2 Region: 3-189
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 2.14e-58
Family Inosicase 0.0000442
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|219852925|ref|YP_002467357.1|
Sequence length 496
Comment phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase [Methanosphaerula palustris E1-9c]
Sequence
MTMKWALLSVWDKTGIVDLAKALVENGINLLSSGGTGAVLKEAHIPFTEVSAYTGSPEMM
GGRLKTLHPKIHGGLLGRRGIDDEVMAEHGIELIDLLVVNLYPFEMMAAKALPLPDLIEY
IDIGGPAMIRAAAKNYHDVAVVTDPAGYERIREAVKRGGFTEDERLELAKLAFARTAAYD
VAISNHLYGLEGGFPPIYSVQFTNGRTLRYGENPHQQAAVYGEFGIADQQPLQGKQMSYN
NYLDLNAAVGLLREFDGPAAVIVKHNNPCGVSVGEEIRTAYLTAREVDPQSAYGSVVALN
REVDAALAEDLCGTFVEVVAAPSFSPGSLVIMKKKENMRVLVLPAPAQADEVRSIDGGLL
VQRTPPHLENWTVVSEREPTEEEMQALRLAWKVCKHTKSNTIIFADQTRTLGIGAGQMSR
VDSAKIAIEKAAGPLNGSAVASDAFLPFPDTLEVAAAAGATALIQPGGSIRDPLVIEAAN
KLNIAMVFTGTRYFRH
Download sequence
Identical sequences B8GED3
521011.Mpal_2351 gi|219852925|ref|YP_002467357.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]