SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|219852982|ref|YP_002467414.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219852982|ref|YP_002467414.1|
Domain Number 1 Region: 7-198
Classification Level Classification E-value
Superfamily SIS domain 1.27e-36
Family mono-SIS domain 0.0000262
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|219852982|ref|YP_002467414.1|
Sequence length 199
Comment 6-phospho 3-hexuloisomerase [Methanosphaerula palustris E1-9c]
Sequence
MEQHRVQGMMQLMATQVASIADTISDEEIDQFIDMLLKADRIYVMGAGRSGLVAKAFAMR
LMHLGLSSFVVGETITPSFTPQDAMVVLSGSGKTKTVADIAETAREIGGNIGLITSNPDS
RIGRIADCIVVLESVRDEIPDDSSEFDIRQMTGEHKSFAPLGTIFETTSMIFADSIISRL
MELRKVDETQLKSRHANME
Download sequence
Identical sequences B8GEJ0
WP_012619010.1.75456 521011.Mpal_2411 gi|219852982|ref|YP_002467414.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]