SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379706560|ref|YP_005261765.1| from Nocardia cyriacigeorgica GUH-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379706560|ref|YP_005261765.1|
Domain Number 1 Region: 4-484
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 9.03e-196
Family Heme-dependent catalases 0.000000000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|379706560|ref|YP_005261765.1|
Sequence length 489
Comment Catalase (monofunctional heme-containing catalase) [Nocardia cyriacigeorgica GUH-2]
Sequence
MTKPTTTNTGIPVESDNESLTAGTQGPVLLHDHYLIEKLAQFNRERVPERIVHAKGSGAY
GELVVTNPEIAKYTKAKLFQPGARTESLVRFSTVAGEQGSPDTWRDPRGFAIKFYTEDGN
YDLVGNNTPVFFIKDSIKFPDFIRSQKRLPGSGLRDHNMQWDFWTLRPESAHQVTWLMGD
RGIPKSYRHMNGYGSHTYQWINAEGERVWVKYHFRTDQGQDFLTQAEADRLAGTDPDLHR
KDLWDAIERGDFPSWTVYVQIMPVAEAESYRFNPFDLTKVWSKKDYPLIEVGKWTLNRNP
RNFFVEIEQAAFEPSNIVPGIGFSPDKMLLGRVFAYADAHRYRIGTNYAQLPPNAPRAAE
VNTYSKEGAMRYHFNEPEVPVYAPNSYGGPHADPELAGDGGAWEFDGKAVRAGYIQHAED
GDFVQPGILVREVLNDEQRDRLVSNIVGHVLGGVQEPVLSRVFEYWKNVDSELGKRVEEG
VRAGLNGNG
Download sequence
Identical sequences H6R9R3
gi|379706560|ref|YP_005261765.1| WP_014348598.1.1905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]