SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379707042|ref|YP_005262247.1| from Nocardia cyriacigeorgica GUH-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379707042|ref|YP_005262247.1|
Domain Number 1 Region: 7-205
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000000696
Family FAD/NAD-linked reductases, N-terminal and central domains 0.056
Further Details:      
 
Domain Number 2 Region: 168-223,254-351,380-391
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000194
Family C-terminal domain of adrenodoxin reductase-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|379707042|ref|YP_005262247.1|
Sequence length 415
Comment lysine-N-oxygenase [Nocardia cyriacigeorgica GUH-2]
Sequence
MAVAAKAHVLRSLGLPAPQVTVVEPHAVGGNWLATGGWTDGQHRLGTSPEKDLGFPYHST
WARGHNQAINEAMMAFSWTAFLVERGTYAEWVDRGRPSPQHNVWAKYLQWVARKIDLDLV
TGRVRKISAAADGWLVTVADSDGVTSEIDADRLMITGPGNSSRALADHPKVLSIAEFWDL
AGKRKLPVSSRAAVIGGGETAGSAMDELVRHDVLTVSVISPGATIYTRGESYFENSLFSD
PAKWRALSIEERRDVMRRCDRGVFSVRVQESLLADNRVHHLQGRVVRVAEQGDGVALTLR
NEMRPDQQHSFDLVVDATGGQALWFLDLFDADAADLVELAIGGPITQARLEAAIGHDLAV
DGLDAKLYLPNLAGLAQGPGFPNLSCLGQLSDRVLATAATCAVPAKAESARSARP
Download sequence
Identical sequences H6QZT8
gi|379707042|ref|YP_005262247.1| WP_014349075.1.1905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]