SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379707526|ref|YP_005262731.1| from Nocardia cyriacigeorgica GUH-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379707526|ref|YP_005262731.1|
Domain Number 1 Region: 6-364
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 6.28e-109
Family FMN-linked oxidoreductases 0.00000000535
Further Details:      
 
Domain Number 2 Region: 336-522
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.88e-42
Family N-terminal domain of adrenodoxin reductase-like 0.0000229
Further Details:      
 
Domain Number 3 Region: 465-523,559-656
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.73e-25
Family C-terminal domain of adrenodoxin reductase-like 0.0000962
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|379707526|ref|YP_005262731.1|
Sequence length 678
Comment 2,4-dienoyl-CoA reductase [Nocardia cyriacigeorgica GUH-2]
Sequence
MRSTSYPHLFEPLDLGHTTLRNRVIMGSMHTGLEDRAWDTNRLAAYFAERARGGVGLIIT
GGYAPNRTGWLLPFGAKLTNKTEAYRHRTITRAVHAEGAKIALQILHAGRYSYMPGSVSA
SSIKAPINPFRPRKLSAKGVEQTIDDYVRCARLAKLAGYDGVEIMGGEGYFINQFLAPRT
NKRTDKWGGSAENRRRLPVEIVRRTRAAVGADFIIVFRLSMAELVEKGQTFDEIVALAQE
LEAAGVSILNTDIGWHEARVPTIVTSVPRAAFVEFTAKITSKVNIPVCASNRINMPEIAE
EILTRGDAQLVSLARPFLSDPEWVNKAAQNRVDEINTCIACNQACLDHAFQHKTVSCLLN
PRAGHETELKLLPTRRSKRIAVVGAGPAGLSAAVNLAERGHRVDLFEADDKIGGQFDIAR
RIPGKEEFDESIRYFTRKIELTGVTLHLGKRATATELIEGRYDEVVLATGVRPRIPNIPG
IDHPMVLTYAELVREEKPVGKRVAVIGAGGIGYDVSEFLTVEGHPTLKLDEWKQEWGVDS
VDEQVRGQLATPVPSPAARDVVLLQRKSGSFGKSLGKTSGWVHRAALKAKGVEQIGGVNY
ERIDDNGLHISFGEKRERPRLIPVDNVVICAGQESVRDLEDELRAAGVNLHLIGGAELAA
ELDAKRAIDQGTRLAARL
Download sequence
Identical sequences H6R5F8
WP_014349556.1.1905 gi|379707526|ref|YP_005262731.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]