SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|379708836|ref|YP_005264041.1| from Nocardia cyriacigeorgica GUH-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379708836|ref|YP_005264041.1|
Domain Number 1 Region: 79-141
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000405
Family NfeD domain-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|379708836|ref|YP_005264041.1|
Sequence length 143
Comment hypothetical protein NOCYR_2635 [Nocardia cyriacigeorgica GUH-2]
Sequence
MAAVVWLVVGILLVAAEMFVGELTLLMLGGGALITAVISFAADTSVVADAIIFAVVSVAL
MLGVRPMLLRRFATPPPTLTNVDALPGKTALVLEDVGAHSGRVKLGGEEWTARPFDPAEE
YPQGTTVYVMKIDGATAVVWKGP
Download sequence
Identical sequences H6R5S4
gi|379708836|ref|YP_005264041.1| WP_014350865.1.1905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]