SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379708994|ref|YP_005264199.1| from Nocardia cyriacigeorgica GUH-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379708994|ref|YP_005264199.1|
Domain Number 1 Region: 15-173
Classification Level Classification E-value
Superfamily PEBP-like 4.84e-51
Family Prokaryotic PEBP-like proteins 0.0000327
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|379708994|ref|YP_005264199.1|
Sequence length 175
Comment hypothetical protein NOCYR_2794 [Nocardia cyriacigeorgica GUH-2]
Sequence
MSHNPYDALPQVPTFTVTSDDVTDGQTFGNDQVSGVFGAGGKDVSPQLSWSGFPAETKSF
AVTVFDPDAPTASGFWHWAVANIPASVTSLPAGAGSQGGELPTGAVQLRNDGGFAGFVGA
APPPGHGPHRYFIVVHAVDVDSLDIPADASPAFLGFNLFSHTLARATLVATYEQH
Download sequence
Identical sequences H6R819
WP_014351023.1.1905 gi|379708994|ref|YP_005264199.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]