SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379709881|ref|YP_005265086.1| from Nocardia cyriacigeorgica GUH-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379709881|ref|YP_005265086.1|
Domain Number 1 Region: 125-366
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.65e-42
Family Spermidine synthase 0.0058
Further Details:      
 
Domain Number 2 Region: 10-121
Classification Level Classification E-value
Superfamily S-adenosylmethionine decarboxylase 3.45e-30
Family Bacterial S-adenosylmethionine decarboxylase 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|379709881|ref|YP_005265086.1|
Sequence length 406
Comment putative S-adenosylmethionine decarboxylase [Nocardia cyriacigeorgica GUH-2]
Sequence
MSVSMTAEFTGWHVLAEFGGVDPELCNDLERLDAALRRSLTGAGVTICDVVRKQFTPQGV
TVLALLSESHASIHTYPESGDIFVDVFTCGSIGDGAEKAVELLREALSPKEVRMSTVRRG
RAGQRVEEPMGPGLTRIWDLSDVLVDTRTEFQHLLIARTEQGISLFSDNDRQSTEYSQLT
YHEAMMVPAFVLAEKLDNVLIIGSGEGVASQMSVAAGATRVDHVDIDREAVQLCAEHLPY
GYTAGELAAAVEGSGPVRVHFADGWDFLANAAAEGVRYDVIVIDLPDERVEDAQHNRLYE
AEFLQRCRALLAPGGVLSAQAGCATMWRNDTLKRSWQRFHDNFGTVVHYGSDEHEWSFLF
GLVDQIDDPVPGMTDRLTTLPYRPATIDARALVRGAIEPYALRQTD
Download sequence
Identical sequences H6R351
gi|379709881|ref|YP_005265086.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]