SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|311103915|ref|YP_003976768.1| from Achromobacter xylosoxidans A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|311103915|ref|YP_003976768.1|
Domain Number 1 Region: 137-191
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.0000000082
Family Rob transcription factor, C-terminal domain 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|311103915|ref|YP_003976768.1|
Sequence length 205
Comment hypothetical protein AXYL_00696 [Achromobacter xylosoxidans A8]
Sequence
MIDLIRDRAMLRALYAPPTGAFSMIDVPKLPFAVWDGAGSPEPSSVTAAIKGLYTAIYPI
RRKARERLGKAFVEPPVELLYWADDMRDFAAGHRENWRWRAQITLPVWANAACLEESAAQ
MRHELNGAPTPRWEALVEGKCVQILHVGPTNDLPAMLEKLYGEHLPQEGLAPSGPYHEIY
LDDWTRTAPTKRKVILRQPVSLLPK
Download sequence
Identical sequences E3HF97
gi|311103915|ref|YP_003976768.1| WP_013391445.1.79376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]