SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|311106992|ref|YP_003979845.1| from Achromobacter xylosoxidans A8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|311106992|ref|YP_003979845.1|
Domain Number 1 Region: 371-537
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 1.16e-28
Family Creatinase/aminopeptidase 0.002
Further Details:      
 
Domain Number 2 Region: 207-345
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 2.49e-25
Family Reductases 0.024
Further Details:      
 
Domain Number 3 Region: 102-198
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 2.33e-19
Family Ferredoxin reductase FAD-binding domain-like 0.0045
Further Details:      
 
Domain Number 4 Region: 13-91
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 4.72e-19
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|311106992|ref|YP_003979845.1|
Sequence length 575
Comment 2Fe-2S iron-sulfur cluster binding domain-containing protein 4 [Achromobacter xylosoxidans A8]
Sequence
MTATCHTITLETGPFLTDGKTSILEAALAQDIPVPFSCQRGACGSCRAVVVDGSYERIAP
PTDGSYQTANDELLMCQCRAASDLTLRFPHWRAPEQPTPPRRASVVSRLPLAPDVTQLIV
ELQDGDDYSYLPGQHAQLILDGGARRNFSIANAPGAAGPARLEFHIRRMPGGAFTDGILP
GLRPGDALTLDAAQGDCTWPAEMPPGIDHLLLLATGTGYAGVAPILMAALQSRALKTVTL
YWGGREPDDCYAGQMLNALQGKGDGFQWHAVLSKAQDGQDADAADGAQHRHAGRHVQDAA
VAAGHDWSRSLVYACGNPAMVSAARERLLAAGLPADRYRAEAFHPAAGGAADIAPQPEAH
PWERISPRYTLAGILDARRRSMQAVEEIAALMRPGMTTREAIAVADDHLRQMGASNNWHP
TYVRFGPDTQSPPVQPTDYDRKLQEHDIFVLDIGPVWDGHEGDYGDTFVLGADADRQRCA
EAAREVFKRARLAWLEGLTGAALYDRASEYARELGCELVREIPGHRVSDFPHALYGKHLL
AQADFVPADGIWVLEIQVRDAQRPIGAFYEDVLLR
Download sequence
Identical sequences E3HPX2
WP_013394444.1.79376 gi|311106992|ref|YP_003979845.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]