SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374335181|ref|YP_005091868.1| from Oceanimonas sp. GK1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374335181|ref|YP_005091868.1|
Domain Number 1 Region: 2-473
Classification Level Classification E-value
Superfamily ALDH-like 3.8e-153
Family ALDH-like 0.00000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374335181|ref|YP_005091868.1|
Sequence length 474
Comment aldehyde dehydrogenase [Oceanimonas sp. GK1]
Sequence
MKMYNNFIHNEFVERAEATKIPVYNPATEEIIGQVSAASAEDAKEAVEIAAAAQKGWRKL
TSIQRGDYLRRLADALVARKDDIGRALALESGKALDEATSEAVYAADITRYHAEWARRIE
GEIIPSDSPSENLLLQREPIGVVACLIPFNYPVYTLMRKIAPALITGNTVVVRPSNNTPC
SAFEIARAVQEAGLPPGVVNVLAMDHSTAEIVCTHPRVGMITLTGSVGAGRKVLEYSQVN
IAKSSLELGGKTPAIVEADADLEKAASQIVASKTTHCGQLCTAVERVYVHEAVYDRFVGL
LRDLFKQREFGDRSKSPGVMGPLINENTRLGIHQMVQRAIDDGATLEVGGYIPEGKGHFY
PPTLLTNCRQDMEIVQEEIFGPVLPVLKYRDAEEALMLANDHQFGLASVIYTENYRTAMM
VANEIEAGEIYINRTPADPYQGYHAGWKRSGLGGDDGKHGMLEFTQTRLVVLSY
Download sequence
Identical sequences H2FXW4
gi|374335181|ref|YP_005091868.1| WP_014291841.1.83795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]