SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374336345|ref|YP_005093032.1| from Oceanimonas sp. GK1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374336345|ref|YP_005093032.1|
Domain Number 1 Region: 3-482
Classification Level Classification E-value
Superfamily ALDH-like 2.36e-152
Family ALDH-like 0.000000662
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374336345|ref|YP_005093032.1|
Sequence length 496
Comment methylmalonate-semialdehyde dehydrogenase [Oceanimonas sp. GK1]
Sequence
MNTISHLINGELHHGNTLLEVFNPATGDVCAQVAMADAATVQQAVAAAEAAFPAWRDTPP
AKRARVMFRYRQLLEDRADDICRLIAEEHGKTLEDARGELQRGIENVEYACGVPGLLKGE
YTRNVGPDIDAWSDFQPLGVVAGITPFNFPAMVPLWMFPMAIACGNCFVLKPSEKDPGSS
LLIARLLEEAGLPKGVLNVVQGGREAVNALLEHKDVKAISFVGSTPVAEYIYATGTANGK
RVQALGGAKNHAVLLPDADLDNAVGALMGAAYGSCGERCMAISVAVCVGDAVADALVAKL
SDSIRALNIGPGTQGGHDMGPVISREHLEKITGYIEDGIAAGATLAVDGRGVTVPGHENG
YFIGGCLFDRVTPEMRIYREEIFGPVLCVVRVNSLEAAIALINAHEYGNGTCLFTRDGEA
ARLFGDQIEVGMVGINVPLPVPVAYHSFGGWKRSLFGDLAAYGPDAVRFYTRRKTITQKW
PERASHQASDFAFPSL
Download sequence
Identical sequences H2FXF0
WP_014292993.1.83795 gi|374336345|ref|YP_005093032.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]