SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374336718|ref|YP_005093405.1| from Oceanimonas sp. GK1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374336718|ref|YP_005093405.1|
Domain Number 1 Region: 18-491
Classification Level Classification E-value
Superfamily ALDH-like 2.09e-164
Family ALDH-like 0.00000000607
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374336718|ref|YP_005093405.1|
Sequence length 494
Comment gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase [Oceanimonas sp. GK1]
Sequence
MQFRNKAHWQAEAEKLQPESRLFIEGQYREAVAGERFAVSNPATNATLAEVSRAQEADVH
LAVLAARASFESGLWSQRAPAERKAVLLKLAALMEQHAEELALLETLDTGKPIRHSLRDD
IPGAVRCLRWYAEAVDKIYGEIAPTGPDALALVSREPIGVVAAIVPWNFPLLLACWKLGP
ALAAGNSVILKPSEKSPLSAIRLAALAKEAGLPDGVLNVLPGFGHEAGKALALHEDVDCL
TFTGSTGVGRLLMEYAGRSNMKRVWLEAGGKSANIVFADCPDLAKAARASAAGIFYNQGQ
VCIAGTRLLVEASIKDAFLAELKKAAEHFKPMDPLDPASTMGTLIDRDHHGSVCRYIAEG
LEQGAVLGLDGREQAGNFMGPTVLEQVNPHMTVAREEIFGPVLAVTTFDQEDEAVQLAND
SQYGLGAGLWTSDLRRAHRLARRLKAGSVFINNYNDGDMTVPFGGVKQSGNGRDKSLHAF
DKFTELKTTWLALD
Download sequence
Identical sequences H2FU28
gi|374336718|ref|YP_005093405.1| WP_014293362.1.83795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]