SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374336983|ref|YP_005093670.1| from Oceanimonas sp. GK1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374336983|ref|YP_005093670.1|
Domain Number 1 Region: 2-417
Classification Level Classification E-value
Superfamily ALDH-like 6.68e-81
Family ALDH-like 0.0000433
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374336983|ref|YP_005093670.1|
Sequence length 441
Comment aldehyde dehydrogenase [Oceanimonas sp. GK1]
Sequence
MTFVSFDPGTGRVLAHHAGMSATRLEQSLALAHEATQEWQQVAPAERAALLFRLASTLSA
ERDRLARELCLETGSLLADCLQEVERCAEECAYFAAHGQAMLPSARSQHGQLPLGLMLAL
TAGPAPLWQCFRLLVPALMAGNGLLLKPAEHLSRLVDVLARLLARAEVPEGLVTPLRISK
EQVAGLVADPRIAGLAYSGERKGGAAMAALAGAQLKPVRLELARADVQLVLDDAELEPAV
ESVLNSCFRYRASWRQSEGGVLITPALADAFLERLTARLTGLRTGRPDEPGVALGPLAKS
GQREWLERQLREAERRGGRIRCGGYLPDEEGWHYPPTLIEGTDPAMTLFPAWPAGPFCGV
LRVPDEAAMLALCRQLSADGMAAIWTQDRSRGERLARALPFDLCRVNPDPYHGRHWPPDA
DPARRPALKEFCRGKTVLVSV
Download sequence
Identical sequences H2FVR3
gi|374336983|ref|YP_005093670.1| WP_014293625.1.83795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]