SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374334240|ref|YP_005090927.1| from Oceanimonas sp. GK1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374334240|ref|YP_005090927.1|
Domain Number 1 Region: 4-130
Classification Level Classification E-value
Superfamily MOSC N-terminal domain-like 1.44e-25
Family MOSC N-terminal domain-like 0.01
Further Details:      
 
Domain Number 2 Region: 283-369
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 5.9e-23
Family 2Fe-2S ferredoxin-related 0.013
Further Details:      
 
Domain Number 3 Region: 2-55,145-261
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 8.72e-23
Family MOSC (MOCO sulphurase C-terminal) domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374334240|ref|YP_005090927.1|
Sequence length 370
Comment flavodoxin reductase family 1 protein [Oceanimonas sp. GK1]
Sequence
MVSITGIHGYPLKSAAGLSLTSALVTREGLAGDRRYMLAKPDGSFVTARTHPRLQRVVVT
PVAGGLELEFAGRRLSVRHRQFSRQPVRTGVWDDDFVAYGTHPDYDAWFSGVLSEPVQLL
WLGDKSNRYRSKLGTAVSFADGYPLLLISEASLADLNRRAGLDLDMARFRPNLVVRGQRP
FEEDGWRRIRVGEVEFLVAKPCSRCIMTTIVAGTERFHAHKEPLATLARYRRGADGEVYF
GQNLVALNEGEIRAGDQVEVLEYATAPVYPNLGEAAPREAEVSRETATLQVRIGEQGFTG
NNQHSLLTQAEQHGLPLSYSCRAGLCGRCKLTLLSGEVHQPEAPALPAAERAAGKVLACC
CVPLSDVTLA
Download sequence
Identical sequences H2G0T8
gi|374334240|ref|YP_005090927.1| WP_014290913.1.83795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]