SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374335378|ref|YP_005092065.1| from Oceanimonas sp. GK1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374335378|ref|YP_005092065.1|
Domain Number 1 Region: 239-761
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 1.3e-187
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.00000000229
Further Details:      
 
Domain Number 2 Region: 777-919
Classification Level Classification E-value
Superfamily ADC-like 1.36e-38
Family Formate dehydrogenase/DMSO reductase, C-terminal domain 0.0019
Further Details:      
 
Domain Number 3 Region: 96-234
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 5.44e-37
Family Ferredoxin domains from multidomain proteins 0.004
Further Details:      
 
Domain Number 4 Region: 22-93
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 5.47e-18
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374335378|ref|YP_005092065.1|
Sequence length 955
Comment formate dehydrogenase subunit alpha [Oceanimonas sp. GK1]
Sequence
MIEYCFPEKDLGTPARESEVHVTLVIDGVEVTVPEGTSVMRAAALVDINIPKLCASDNLE
AFGSCRLCTVEIEGRRGYHASCTTPVGEGMVVRSQTQGLAKLRRNIMELYISDHPLDCLT
CPANGDCELQDMAGDVGLREVRYGFAGENHLSLGKDESNPYFTFDASKCIVCSRCVRACG
EVQGTFALTLEGRGFDSKVSTGRDNDFLSSDCVSCGACVQACPTATLTEKSVIEQGQPEH
SVVTTCAYCGVGCSFKAEMKGDQLVRMTPYKGGQANHGHACVKGRFAFGYATHKDRLTQP
MIRDAIDQPWREVSWDEAIGFAARRLREVQQQHGKHSVGGITSSRCTNEETYLVQKLVRA
ALGTNNTDTCARVCHSPTGYGLKMTLGESAGTQDFDSVLQSDCILVIGANPTDAHPVFGS
LLRKRLRQGAQLIVADPRHIDLLDTPHTAEALHLPLRPGANVALVNALAHVIVTEGLEDQ
DFIAARCAPEDYAAWHEFIADPRHAPEVMSDVIGVPAERIREAARRYAGAGNGAIYYGLG
VTEHSQGSTTVMGIANLALATGNIGRPGVGVNPLRGQNNVQGSCDMGSFPHELPGYQPVT
DAAVRASFERAWGAELHAEPGLRIPGMFDAAIEGRFKALYVQGEDIAQSDPNTQHVEAAL
RALDLLIVQDIFLNETAKFAHVILPGATFLEKNGTFTNAERRINRVRKVMAPLAGKEDWQ
VTQELAQALGYPMHYEHPSEIMAEIASVTPSFAGVSYAKLEELGSIQWPCNDEHPTGMPV
MHGDSFPIGLGRMVVTEFMPTSERVSEAFPLLLTTGRILCQYNVGAQTRRTQNNVWHGED
VLEIHPHDAAARGIVDGQAVTIASRTGNTVLRAKHSQRMQPGVVYTTFHFPHSGANVITT
DNSDWATNCPEYKVTAVQVSGTSDRALSDWQRRFEAFTEQQLAFAEQAHHSVKEH
Download sequence
Identical sequences H2FTD6
gi|374335378|ref|YP_005092065.1| WP_014292038.1.83795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]