SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374335383|ref|YP_005092070.1| from Oceanimonas sp. GK1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374335383|ref|YP_005092070.1|
Domain Number 1 Region: 107-250
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 5.76e-37
Family Reductases 0.061
Further Details:      
 
Domain Number 2 Region: 13-118
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.38e-30
Family Ferredoxin reductase FAD-binding domain-like 0.0048
Further Details:      
 
Domain Number 3 Region: 243-367
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.7e-23
Family 2Fe-2S ferredoxin-related 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374335383|ref|YP_005092070.1|
Sequence length 368
Comment nitric oxide dioxygenase [Oceanimonas sp. GK1]
Sequence
MNQDFLSPINTQTWSNGRHPVRCVRVIQETWDVRTFCFSAESPLLFFFKPGQFVTLELEI
DEQTVMRSYTIASSPSVPYSFSITVKRVPGGVVSNWLHDNLKEGDALAVHGPVGNFNCID
FPNEKVLLLSGGVGITPVMSMLRWWFDTNAEVDIQFVHSARTPKDLVFHRELQHMDSRLS
NIQLSLICERTDIGETWSGYRGFLNSAMLAQLSPDFMEREVFCCGPAPYMKAVRNLLQQA
GFDMDHYHEESFGATPVEVIEDVELLAQEASDLAEQLERTEERLSVSFLESDLQASILPG
ETLHSAAAQVGLHIPKACGMGICGTCKVKVAKGRVNMEHNGGITDEDIADGYVLSCCSVP
EEDVDVAF
Download sequence
Identical sequences H2FTE1
gi|374335383|ref|YP_005092070.1| WP_014292043.1.83795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]