SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374336951|ref|YP_005093638.1| from Oceanimonas sp. GK1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374336951|ref|YP_005093638.1|
Domain Number 1 Region: 557-1038
Classification Level Classification E-value
Superfamily ALDH-like 6.81e-131
Family ALDH-like 0.000000623
Further Details:      
 
Domain Number 2 Region: 190-533
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 4.32e-112
Family Proline dehydrohenase domain of bifunctional PutA protein 0.000000016
Further Details:      
 
Domain Number 3 Region: 18-189
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 1.83e-63
Family N-terminal domain of bifunctional PutA protein 0.0000211
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374336951|ref|YP_005093638.1|
Sequence length 1055
Comment bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase [Oceanimonas sp. GK1]
Sequence
MFTVATVFAPDYRPTDLAALRQDITHNYAVDENAWLARLLEQLPASGPELAQLEEQARRL
VTRVRAESDGGDGIDAFLQQYSLDTQEGIILMCLAEALLRIPDSHTADELIKDKLSGADW
ARHFRQSDSTLVNASTWGLMLTGRIVRMDKKLDGNPANVLSRMINRLGEPVVRSAMYAAM
KIMGKQFVLGRTITEALKASRKSREQGYTHSYDMLGEAAMTAADAEKYRADYASAIAAVG
GEKLNNPEVPRPSISIKLSALHPRYEEANRERVLTELYATVQGLLETARKLDVCITIDAE
EMDRLELSLSLFEKLYRSEVNRGWGGLGLVVQAYSKRALPVLCWLTALAREQGDEIPLRL
VKGAYWDSEIKHSQQAGLDGYPVYTRKAGTDVAYLVCARYLLSAATEGAIYPQFATHNAH
TVVAVLSMAGQRRFEFQRLHGMGEELYDAVLADNPGLHCRIYAPVGAHKDLLPYLVRRLL
ENGANTSFVHKLVDPDTPVDALITHPVTSLRHCPSLANDKIPLPRDIFADRKNSAGINLN
IDAVRTPLFQQLDALAGKRWQAAPLVGGKAVTGEPRPVMSPQNRQHQVGTVVFADKGTVE
QAITQAENAFKGWRDTPVETRAQALEKLADLLEAHSAEFISLCTREAGKLLQDGIDEVRE
AVDFCRYYANEGRRLMGEPAKLPGYTGELNLLQAQGRGPFVCISPWNFPLAIFLGQVSAA
LITGNTVLAKPAEQTSLIAHLAVTLAHEAGIPGDVLQLLPGDGAITGAALTGDLRIAGVC
FTGSTDTARLINQTLAQRSGAIVPLIAETGGQNAMIVDSTALPEQVVRDVLRAAFQSAGQ
RCSALRVLYLQDDIADRVLEILEGAMQELSVADPALWSTDVGPVIDADAQAGLQAHLDAM
KAAGRKVLAEAPMSEACAGGFYLRPTAIEIGSIGELDKEQFGPILHVVRFKAKDIDLVID
DINATGYGLTLGIHSRNESFAAQVAKRAEVGNIYINRDQIGAMVGVQPFGGRGLSGTGPK
AGGPHYLTRFITEKTVTNNTTAIGGNATLLSLGEG
Download sequence
Identical sequences H2FVF0
gi|374336951|ref|YP_005093638.1| WP_014293593.1.83795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]