SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374336984|ref|YP_005093671.1| from Oceanimonas sp. GK1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374336984|ref|YP_005093671.1|
Domain Number 1 Region: 452-558
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000667
Family Anti-sigma factor antagonist SpoIIaa 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374336984|ref|YP_005093671.1|
Sequence length 594
Comment sulfate transporter [Oceanimonas sp. GK1]
Sequence
MPEPTAGYCSRWQRLLPFLGWWPLVNPASLRADAQSGLTNAIVVLPQGVAYALIAGLPPE
YGLYAAIVPAIIAALFGSSWHLISGPTAAMSVVVFTSVSPLAEPGTATFIALALTLTLMK
GVFQLVLAFARLGVLVNFVSQSVVIGFTAGAAVVIASSQLPTLLGITVDGNGSVTGTWWQ
LLHHLTEVDYYSLSVALFTVAACVGIKRWRPRWPNMLIALALASGLALLIDPDHEHIALV
GAIPAGLPPLSLPDFSLASISALAPGALAISLLGLVEAAAISRAIASRSHQRLDDNQEFI
GQGLSNLVGAFFSCYASSGSFTRTGINYTSGARTPMAAIFASGFLLLILLLIPGITTWLP
LPAMAGLLLVVAWNLIDVHHIGLIIRGSRSETTVLTATFAATLLVELEFAIYTGVILSLV
FYLKRTSTPRVVSILPDPDSKHPFFVNAERRRLPYCPQLRIVRIEGSLFFGAVNHVQEYL
QAIREPRLLIVGNGINFVDMVGADMLVQEAERRRELGGDLYLCNLREGVLRFLLRNNRLD
DIRRDHVFINKGQAIHRIYDQLDAEVCRTCTARIFRECHLRPPGQPAEKAKAEG
Download sequence
Identical sequences H2FVR4
WP_014293626.1.83795 gi|374336984|ref|YP_005093671.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]