SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374337003|ref|YP_005093690.1| from Oceanimonas sp. GK1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374337003|ref|YP_005093690.1|
Domain Number 1 Region: 181-358
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 4.09e-52
Family CO dehydrogenase flavoprotein N-terminal domain-like 0.0000353
Further Details:      
 
Domain Number 2 Region: 363-469
Classification Level Classification E-value
Superfamily CO dehydrogenase flavoprotein C-terminal domain-like 1.57e-35
Family CO dehydrogenase flavoprotein C-terminal domain-like 0.0001
Further Details:      
 
Domain Number 3 Region: 93-174
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 8.5e-35
Family CO dehydrogenase ISP C-domain like 0.00011
Further Details:      
 
Domain Number 4 Region: 2-85
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 2.02e-18
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374337003|ref|YP_005093690.1|
Sequence length 481
Comment putative xanthine dehydrogenase subunit XdhA [Oceanimonas sp. GK1]
Sequence
MITFLLNQELRQEQDLSPNMTVLNYLRTRVGKTGTKEGCGSGDCGACTVVLGERDGDRIR
YRSVNSCLTFVSALHGKQLITVEDLKSRDGGLHPVQQAMVDFHGSQCGFCTPGFIMSMFA
LSKNKPAADKHDILEALAGNLCRCTGYRPIVDAAKAIAEQPQLADEFSRYEQQLVARLAN
IETDTLVTLSGDDKVCFSPTTSDELATLLEQHPDARLLAGGTDLALEVTQFHRELPTMIY
VGNVADMKTLEETDEAIIIGAARSLSDSYEALSTVYPDFGELLHRFASLQIRNQGTLGGN
VGNASPIGDAPPVLIALNARLVLRKGDRVRELPVDEYFLSYKVTAQEQGEFIERIIVPKP
SANQHFRVYKLSKRLDDDISAVCGAFNLIIENGIVTDARIGFGGMAATPKRATGCEQALL
GQPWNMATVKAGMKALEADFEPLSDFRASKEYRTRTAANLLYKCFIEQQDLKLETRVTSY
V
Download sequence
Identical sequences H2FVT3
WP_014293645.1.83795 gi|374337003|ref|YP_005093690.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]