SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386029638|ref|YP_005950413.1| from Oligotropha carboxidovorans OM4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386029638|ref|YP_005950413.1|
Domain Number 1 Region: 7-263
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 9.32e-77
Family FdhD/NarQ 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386029638|ref|YP_005950413.1|
Sequence length 273
Comment FdhD family protein [Oligotropha carboxidovorans OM4]
Sequence
MTEPTVSAHRQIWRENGLSEGIRVVPEETALAMSYGASTHAVMMGTPQDLEDFAVGFSLT
EGIIDNVDGIESLEVVPQDEGIELRMWLSGTEAARQSERRRHIAGPTGCGLCGIDSIAEA
MRPVALVGTGITVTPAQIMTAMQALYPLQKLNTLTRAVHAAAFWDPEKGILECREDVGRH
NALDKLAGALARNRIDGASGAVLLTSRVSVEMVQKTAVIGASLIVSVSAPTALAIRMAER
AGITLCAIARSDGFEIFTYPNRVKTDDAAIHVA
Download sequence
Identical sequences B6JG75
gi|337740621|ref|YP_004632349.1| 504832.OCAR_6676 gi|337740621|ref|YP_004632349.1| WP_012563813.1.10663 WP_012563813.1.50963 WP_012563813.1.53695 gi|386029638|ref|YP_005950413.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]