SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000020993 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000020993
Domain Number 1 Region: 256-532
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 4.1e-112
Family N-acetyl transferase, NAT 0.0000000269
Further Details:      
 
Domain Number 2 Region: 6-97
Classification Level Classification E-value
Superfamily Chromo domain-like 1.44e-21
Family Chromo barrel domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000020993   Gene: ENSDARG00000004587   Transcript: ENSDART00000006983
Sequence length 541
Comment pep:known_by_projection chromosome:Zv9:5:25266093:25274878:1 gene:ENSDARG00000004587 transcript:ENSDART00000006983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADHSVEITEGCRLPVLRRNQENEDEWPLAEILSVKDISGRKLYYVHYVDFNKRLDEWVT
PDRLDIKKLQFPKKEAKTPMKNGLSGSRPSSPERDVKKSLDLHVQSASAPSRGKTVPTPK
RKAESVSLATQVTAATPVPSLPASTEASQAALYTAIRDASFNIKSREEHEPLTSLTTNGT
TSIQRHLIPPQPGRKRKNCGGTDEMVKVFQNNSPRCSTVYLLPGEDSQDSSDGIPSAPRM
TGSLVSDRSHDDIVTRMKNIGCIELGRHRLKPWYFSPYPQELTSLPIIYLCEFCLKYLKS
LKCLQRHLTKCNLRHPPGNEIYRKGTISFFEIDGRKNKAYSQNLCLLAKCFLDHKTLYYD
TDPFLFYVMTEYDPKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYEL
SKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILMDLKSENGERPQITINEISEITSIKK
EDVISTLQYLNLINYYKGQYILTLSEDIVEGHECAMQKRHLRIDPKCLHFTPKDWSKRGK
W
Download sequence
Identical sequences Q6DHD0
NP_001002365.1.45394 ENSDARP00000020993 ENSDARP00000020993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]