SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000021648 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000021648
Domain Number 1 Region: 295-562
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.98e-114
Family N-acetyl transferase, NAT 0.0000000189
Further Details:      
 
Domain Number 2 Region: 142-184
Classification Level Classification E-value
Superfamily CCHHC domain 0.0000000000000392
Family CCHHC domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000021648   Gene: ENSDARG00000031770   Transcript: ENSDART00000004896
Sequence length 568
Comment pep:known chromosome:Zv9:12:6664829:6682434:-1 gene:ENSDARG00000031770 transcript:ENSDART00000004896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRRKGHKSPFQLILNKPINTERTAGSSSDGTADSDDSGDHEKTDSSHGEANQRNNTRMT
RASLRLSQSSQDAPPDIKQAVERDESPPRTPTGNAPSSESDIDISSPNASHDESVTKDQK
DSGSDPSHRPKRRRFHESYNFNMKCPTPGCNSLGHLTGKHERHFAISGCPLYHNLSADEC
KVKAIEREKQDEERSQGQNEENRHATRHQAPTPRQVRYKEKVIEMRKRRDSGLSKDQKEK
YMEHRQTHGTTREPLLENITSDYDLELFRKAQARASEDLEKLRLQGQITEGSNMIKTIFF
GRYELETWYHSPYPEEYARLGRLYVCEFCLKYMKSQTILRRHMAKCVWKHPPGDEVYRKG
ATSVFEVDGKKNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLVGYFSK
EKNSFLNYNVSCILTMPQYMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSY
WKEVLLRYMYNFKGKEISIKEISQETAVNPVDIVSTLQSLQMLKYWKGKHLVLKRQDLID
DWKAKETKRGNSKTIDPGSLKWTPPKGT
Download sequence
Identical sequences Q7ZW29
ENSDARP00000021648 ENSDARP00000021648 NP_997800.1.45394 7955.ENSDARP00000021648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]