SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000023863 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000023863
Domain Number 1 Region: 5-216
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.67e-66
Family D-ribulose-5-phosphate 3-epimerase 0.00000184
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000023863   Gene: ENSDARG00000005251   Transcript: ENSDART00000021218
Sequence length 228
Comment pep:known chromosome:Zv9:9:25058789:25064806:-1 gene:ENSDARG00000005251 transcript:ENSDART00000021218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYTAKIGPSILSSDLSQLGRECERMMECGADYLHLDVMDGHFVPNITFGHPMVECLRSC
IGPDPFFDMHMMVSRPEQWVKPMAAAGANQYTFHLEATSNPGNLIKEIRESGMKVGLAIK
PGTTVEELAPWAGQIDMALVMTVEPGFGGQKFMEDMMPKVSWLRGQFPSLDIEVDGGVGP
DSIHRCAEAGANMIVSGSAVVSSDDPRSVIALLKNVVMEAIQKRSLDR
Download sequence
Identical sequences Q6PBW9
ENSDARP00000023863 NP_001230353.1.45394 7955.ENSDARP00000023863 ENSDARP00000023863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]