SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000024632 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000024632
Domain Number 1 Region: 293-492
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.93e-89
Family N-myristoyl transferase, NMT 0.0000000358
Further Details:      
 
Domain Number 2 Region: 111-292
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.8e-80
Family N-myristoyl transferase, NMT 0.000000322
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000024632   Gene: ENSDARG00000021808   Transcript: ENSDART00000012157
Sequence length 493
Comment pep:known chromosome:Zv9:16:30806655:30827565:1 gene:ENSDARG00000021808 transcript:ENSDART00000012157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAEDSESAASQQSLELDDQDTCGIDGDNEEENEHMQGSPGGDLGAKKKKKKQKRKKEKP
SSGGTKSDSASDSQEIKNPAIPMQKLQDIQRAMELLSTCQGPAKNIDEATKHKYQFWDTQ
PVPKLNEVVTTHGPIEPDKENIRQEPYSLPQGFMWDTLDLSNAEVLKELYTLLNENYVED
DDNMFRFDYSPNFLKWALRPPGWLPHWHCGVRVSSNKKLVGFISAIPADIHIYDTLKRMV
EINFLCVHKKLRSKRVAPVLIREITRRVNLEGIFQAVYTAGVVLPKPVSTCRYWHRSLNP
RKLVEVKFSHLSRNMTLQRTMKLYRLPDSTRTPGLRTMGDRDVKQVTALLQKHLSQFHLR
PVMGEEEVKHWFLPQENIIDTFVVEGSGGMLTDFISFYTLPSTVMHHPLHKSLKAAYSFY
NVHTETPLIDLMNDALILAKLKGFDVFNALDLMDNKNFLEKLKFGIGDGNLQYYLYNWKC
PPMDPEKVGLVLQ
Download sequence
Identical sequences H2ZRH9
ENSDARP00000024632 ENSDARP00000124979 ENSDARP00000024632 NP_001186683.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]