SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000029934 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000029934
Domain Number 1 Region: 65-187
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 8.83e-16
Family N-acetyl transferase, NAT 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000029934   Gene: ENSDARG00000024109   Transcript: ENSDART00000039265
Sequence length 237
Comment pep:known chromosome:Zv9:7:26167151:26178688:1 gene:ENSDARG00000024109 transcript:ENSDART00000039265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRKSNRAKEKKQRRLEERAAMDAVCAKVDAANKLEDPLSAMPVFKKYDRNGLNLQIECK
RVTALSPDTVEWAYELTRANMQTLYEQSEWGWKEREKREEMKDERAWYLLARDADSTPLA
FSHFRFDVECGDEVLYCYEVQLESKVRRKGLGKFLIQILQLIANSTQMKKVMLTVFKHNH
GAYQFFREALQFEIDETSPSMSGCCGEDCSYEILSRRTKYGEVSGHAHGGHCGGCCH
Download sequence
Identical sequences Q568K5
GO.79306 ENSDARP00000029934 NP_001017632.1.45394 7955.ENSDARP00000029934 ENSDARP00000029934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]