SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000042494 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000042494
Domain Number 1 Region: 3-159
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.66e-36
Family N-acetyl transferase, NAT 0.000000478
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000042494   Gene: ENSDARG00000032272   Transcript: ENSDART00000042495
Sequence length 171
Comment pep:novel chromosome:Zv9:24:22581877:22586792:1 gene:ENSDARG00000032272 transcript:ENSDART00000042495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANFNLRKAEPKDVPDILRLIKELAKYEEMEDQVLITEKDLLEDGFGEHPFYHCVVADVS
AEHQKVEGYSVIGFAMYYFTYDPWIGKLLYLEDFYVMKEYRGFGIGSEILKHLSDTAVKN
RCSSMHFIVAESNKTSIDFYKRRGASDLSLQEGWRLFRIDKENLLKMSAEE
Download sequence
Identical sequences Q7T174
ENSDARP00000042494 7955.ENSDARP00000042494 NP_001087217.1.45394 ENSDARP00000042494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]