SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000049367 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000049367
Domain Number 1 Region: 67-140
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000563
Family N-acetyl transferase, NAT 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000049367   Gene: ENSDARG00000004472   Transcript: ENSDART00000049368
Sequence length 305
Comment pep:known chromosome:Zv9:19:27965228:27992033:1 gene:ENSDARG00000004472 transcript:ENSDART00000049368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFPYDLNALFPERISVLDSNLSAGRKAHGRPDPLPQVTTVIDELGKASSKAQQLPAPIT
SAAKLQANRHHLYLLKDGEQNGGRGVIVGFLKVGYKKLFLLDQRGAHLETEPLCVLDFYV
TETLQRHGYGSELFDFMLKHKQVEPAQMAYDRPSPKFLSFLEKRYDLRNSVPQVNNFVVF
AGFFQSRSGTPPSPLTDQGMYGFFGPTEKSSPKKARGRDQTLFANGKRSGSGGAEGSPLA
ICSPRGSPPLSPSTSVISSIPFSQCGILPQPGPASPRRGHGPPAGSDPLIPAQRQLQGKT
HQFSK
Download sequence
Identical sequences ENSDARP00000049367 GO.72095 7955.ENSDARP00000049367 NP_998423.1.45394 ENSDARP00000049367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]