SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000052921 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000052921
Domain Number 1 Region: 2-153
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 5.57e-32
Family N-acetyl transferase, NAT 0.0000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000052921   Gene: ENSDARG00000036430   Transcript: ENSDART00000052922
Sequence length 171
Comment pep:known chromosome:Zv9:7:21802773:21809332:1 gene:ENSDARG00000036430 transcript:ENSDART00000052922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFTIRAATFEDCKDISRMILELAEFEKVSDHVKITQRDLEQDGFSKNPFFHGIIAEVPE
HLKSREGHTKIGYSLYFYMYNTWKGRAVYMVDLYVMAEFRGKGIGKALMTKVSQLGLAAG
CTQLNFTVLDWNKSSLDFYLKQGCWDVTSELGYHCMRCEGEALQHLAQGEL
Download sequence
Identical sequences Q5PR44
7955.ENSDARP00000052921 ENSDARP00000052921 ENSDARP00000052921 NP_001008598.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]