SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000055786 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000055786
Domain Number 1 Region: 17-103
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 3.61e-19
Family N-acetyl transferase, NAT 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000055786   Gene: ENSDARG00000038281   Transcript: ENSDART00000055787
Sequence length 110
Comment pep:known_by_projection chromosome:Zv9:3:15422243:15428699:1 gene:ENSDARG00000038281 transcript:ENSDART00000055787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQAAQINVLDISTRLRVEHDKKRRQFSIRLNGSHDKAVLLYEYVGKKTVDLQHTEVPEA
YRGREIAKHLAKAAMDFVVEEDLKAHLTCWYIQKFVKENPHPQYLERILH
Download sequence
Identical sequences Q5D014
NP_001013336.1.45394 ENSDARP00000055786 7955.ENSDARP00000055786 ENSDARP00000055786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]