SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000057697 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000057697
Domain Number 1 Region: 114-185
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00000671
Family N-acetyl transferase, NAT 0.097
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000057697
Domain Number - Region: 355-440
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000373
Family N-acetyl transferase, NAT 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000057697   Gene: ENSDARG00000039491   Transcript: ENSDART00000057698
Sequence length 500
Comment pep:known_by_projection chromosome:Zv9:20:49356093:49382153:-1 gene:ENSDARG00000039491 transcript:ENSDART00000057698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAHASFSDHPIEELVDQACWQNRLQNYASAEKLTPMNTLFLRLFVAQPGFSIGGAKEIFR
TVFSAVVELEHICLLTPYGGALEAALQKIFEPMTSVTDEAQYSAYVCHRHDHCPRLHIRK
ARVEDHDDLMHIFGEQITPLVETYGPFVLSELIETQEQEHHTAVCESDGAVVGFISVSAH
VDLKLLNKCFELGAFEGLTKTDPSQQEEPHQLEEENPADDAQQSDETNEPVERIMLHFIN
GHYARVSLPCGERAQYCLPKDLNVSSGATKYTEPCIKETVDCCEDSEPDGPSNAFCIQLF
TMEKKFEMRSADFLPYLFKLFPERDFCVISVPKQAADFPLLQSFIRVAPRDTSTFPQELY
LCHRWGLTRRLEVRVAVSSDIPAVQSLTESLSQRDSIIEDLDLFLQARKNSDGTALQAFV
AHVDGRVVGLIITRDEEDIEFIRANFDIERFMYFSHNQREEHGRLCHFLLSPVFQHYTKY
IFREVLRLAHKSCLYYLLPP
Download sequence
Identical sequences ENSDARP00000057697 ENSDARP00000057697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]