SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000057699 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000057699
Domain Number 1 Region: 1-156
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 8.19e-29
Family N-acetyl transferase, NAT 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000057699   Gene: ENSDARG00000039493   Transcript: ENSDART00000057700
Sequence length 178
Comment pep:known chromosome:Zv9:20:49410575:49422584:-1 gene:ENSDARG00000039493 transcript:ENSDART00000057700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTLRAFTCDDLFKFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGK
AEGSVAREEWHGHVTALSVAPEFRRLGLAAKLMEMLEEISERKGGFFVDLFVRVSNQVAV
NMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSIIPLPHPVRPEDIE
Download sequence
Identical sequences B2GQZ5 Q58ED9
ENSDARP00000057699 NP_001014351.1.45394 ENSDARP00000057699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]