SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000058350 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000058350
Domain Number 1 Region: 36-179
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.16e-20
Family N-acetyl transferase, NAT 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000058350   Gene: ENSDARG00000039892   Transcript: ENSDART00000058351
Sequence length 184
Comment pep:known chromosome:Zv9:17:15054735:15061179:1 gene:ENSDARG00000039892 transcript:ENSDART00000058351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLDETPLFDPSLLQELDWSSNSVSFLPAISPFQPGEGLVLRPLCTADLNRGFYKVLAQL
TEAGDVTEEQFKANFEHMKKSGDYYVIVVEDTNLGQIVATATLIIEHKFIHACAKRGRVE
EVVVSDVCRGKQLGKLLVSTLTLLSKKLQCYKVTLECAPKNVEFYRKFGYSASDETYMQC
RFFK
Download sequence
Identical sequences Q4VBJ4
7955.ENSDARP00000058350 NP_001019545.1.45394 XP_005169882.1.45394 ENSDARP00000058350 ENSDARP00000058350 ENSDARP00000112961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]