SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000068164 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000068164
Domain Number 1 Region: 41-272
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.8e-32
Family Hypothetical protein cg14615-pa 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000068164   Gene: ENSDARG00000051954   Transcript: ENSDART00000073674
Sequence length 284
Comment pep:putative chromosome:Zv9:11:43800828:43810723:-1 gene:ENSDARG00000051954 transcript:ENSDART00000073674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIILTSEELKQAESVLKNFFPESIKVYGCIFNINRGKPHNLEVIADLWPEFTVIICKPKV
QGVKNREGDFNIYSIYSKSKDSLKSFLDTPGVINKDAFTLLAGVDIRHLGAVQEFADQHG
IPSKVQGVMNVLVLQDQQQLQFKDRHAGLSFAPLSTAHAHLVNSTWKYGGDSSSYNSVLN
YISHNPSLCVIEEGQTEPVSWLLVYPHAALGLLYTLPQHRCKGYARLLVSIMSKNLLEQG
HPVYCFVEEENKPSYKLFTSLGFQNSPDYRAVWFELNKQQVRDE
Download sequence
Identical sequences XP_009304583.2.45394 XP_009304584.2.45394 ENSDARP00000068164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]