SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000072241 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000072241
Domain Number 1 Region: 705-971
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.2e-109
Family N-acetyl transferase, NAT 0.00000000132
Further Details:      
 
Domain Number 2 Region: 257-326
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.19e-16
Family PHD domain 0.0063
Further Details:      
 
Domain Number 3 Region: 99-179
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000158
Family Linker histone H1/H5 0.032
Further Details:      
 
Domain Number 4 Region: 201-270
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000309
Family PHD domain 0.022
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000072241
Domain Number - Region: 1700-1750
Classification Level Classification E-value
Superfamily Ribosomal proteins L15p and L18e 0.0061
Family Ribosomal proteins L15p and L18e 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000072241   Gene: ENSDARG00000055429   Transcript: ENSDART00000077775
Sequence length 2043
Comment pep:known chromosome:Zv9:13:25093683:25130197:-1 gene:ENSDARG00000055429 transcript:ENSDART00000077775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKLANPLYTEWILEAIQKIKRQKQRPSEERICHAVSSTRGLDKGVVLHQLELAVKDGSI
LKVTSKGCASYKDPDNPGRITPFKLGGSGTVSVGSVIPAGDLRHVDWNKILRRAIEGLGV
PSGSSLRNIERFLRSQGDLVNVVANPRFQQRLRLAAKRAVNNGRLLKDGPLYRLNSGGLG
GKSCFRNVGVFGVDLPPVTLLPHERDQPRADPIPICSFCLGTKESNRDKRPEELLSCADC
GSSGHPSCLKFSADLTANVKALRWQCIECKTCSSCQIQGKNADEMLFCDSCDRGFHMECC
DPPLSRMPKGMWICQVCRPKEQEGKRLLHKTAAQIKRRYAKPGRPRKNLAHPTMSDSGGP
GSVELSEKARHGRGSISTFCTPPSSSTFIPTTDGRSLTDPLTSTPTLTTLPPINKKTKGL
IDGLSKFFTPSPLGRRLRGEASGSSNQHRPRKRGYRKHHASMMTPGVRLNAPSSVLLTPS
PSQGHSPISLNPTQSSSPSSAHSPHSSSSQSSGPSLSSLPGNSQLKGLFDGLSHIFTTQG
QSRQKGLPSYAPPKRVRRTQDMSTSPKMSLQLQGKKPVKGFCSKLASLASSASGWPPKRG
RPFKSALHFKRTPILRKHKLLGRFRFKASPQRENITPGKGRLADGRVKPDPNHAFNVERC
LRREPQEGRMTLVNDHVAEEDLKLFRHVKELTAKKNGGDQGQSPPLIEFGKYEIQTWYSS
PYPPEYLRLPKLYLCEFCLKYMKSQDILQRHSKKCGWFHPPANEIYRKDNLSVFEVDGNI
SKIFCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQNDEKGCHLVGYFSKEKLCQQKYNVS
CIMIMPQFQRQGFGRFLIDFSYLLSRLEGQAGSPEKPLSDLGRLSYLAYWKSVILEYLHN
HPDKSVSIRGMSRATGMCPHDIATTLQQLNMIDFQDGRFVIIQRHQLIEEHMDRLRVKPR
LHEVDPDCLSWTPALVCRSPPVDLKSALALARDHRADYTASTRNLAMGMGYIGTRPPLTK
CKNFRRRYSDPLFGNSTGKDFEVSEESSSDDDDDNNDDDDDDEDGEDSAVQSQSGQGLKR
RRAPTMRRKRGRRRTRINSSVTTETILERTEVLDEPFENSDVESPLPEHSRRCCSEDEEE
EKSQRSAVCRPGRPRTNEEDNHSNQSKEEENVEVKKDNPRPAKRKKGWPKGVKRGPPKWR
LKERKMGFKLNLYTPPETPMVTVEQEQDDEQDASPASFSGPCQSFRESRPEDPELDTCVS
VPPSPEPPKSHKVNEDESTDKSDTVENSPSADDTNETTPGPIDDPEQSTQNAEELEDLKP
EGETEGRPVKGSGEGDEEEDEDEEPEPSHLDDHDADDEDDSHEQRMEDPVPLPERDLTED
TEPSPSNNNNKQPEEQPSPGEPPSHCSEELASESALVNLGMQDGDTVDSDHTPDSETEEE
DNLEKPEEKQMGPLTPAIKEDHNICPELDMETAQAVQSLTQESEQERHFQDCAETQEACH
SLQRYVHVEQSPQMTPVDDCQQSDHSSPLSSVHSHPSQSVRSVNSPAVSILESGYTQISP
DQGTVSVHSLHNNMETSPIMDVPSVSDHSQQVVDSGFSDLGSIESTTENYENPSSYDSTL
GNSICGTGAGAGASSQSSCSYGNLSSGGSHSQSSCAVSQQMAGPVVNNTGACSMLQQTSM
SSPQGCSVKSPQGCVPERQPSHSHGHGHGHGHGHGHSHSHHHSHHQHHPHHQHHQHPQHQ
YQQPLSHCSMPASFPPPPMQLPDIPESNNPSTNLGLYDRMGQGEYGTGHYGHLHKLQQLT
NTIMDHSLPFSHSASHSIPSYANNNGSLSTQLGPHNPTLVSLSQPGGGPQSQSTVTPPPN
MTPPPMMLQRNMATPNMNLAPSQRLQTQMPPKNHHHHPVSIRSKSAPLPPHHQQQMYGRG
PQSVAMQAPGRTLAMPTRMNMGVNLMPAPAYNVNSMNVNVNMAMNTYRVTQPMMNGGYHG
NPTYMNQSPQYSMQMGMMGTQPYPQQPMQAPPHGNMMYSPAGHHSYVNTGMSKQPLNGPY
MRR
Download sequence
Identical sequences F1R4F8
ENSDARP00000072241 ENSDARP00000072241 XP_009305669.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]