SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000081428 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000081428
Domain Number 1 Region: 13-182
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 4.08e-22
Family N-acetyl transferase, NAT 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000081428   Gene: ENSDARG00000061185   Transcript: ENSDART00000086994
Sequence length 242
Comment pep:known chromosome:Zv9:3:27937720:27947470:1 gene:ENSDARG00000061185 transcript:ENSDART00000086994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDVVPTTALSEIQLRLLCHDDIDRIKVLCGEWFPIEYPDSWYHDITSNKKFFSLAATFR
GGIVGMIVAEIKSRTKVHKEDGDILASSFPVDTQVAYILSLGVVKEFRKHGIGSLLLDSL
KEHISTTAQDHCKAIYLHVLTTNNTAIHFYENRDFKQHHYLPYYYSIRGVLKDGFTYVLY
INGGHPPWTIFDYIHHIGSALASLSPCSIPQRIYRQAQNLLRSFLPWSGISSKSGIEYSR
TM
Download sequence
Identical sequences A3KPA3
NP_001076341.1.45394 ENSDARP00000081428 7955.ENSDARP00000081428 ENSDARP00000081428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]