SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000089698 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000089698
Domain Number 1 Region: 14-265
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.51e-26
Family Histidine biosynthesis enzymes 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000089698   Gene: ENSDARG00000068410   Transcript: ENSDART00000098928
Sequence length 268
Comment pep:known chromosome:Zv9:7:47619385:47629279:-1 gene:ENSDARG00000068410 transcript:ENSDART00000098928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFLNLFGRLQSNIIGMIHVRALPGTPLNRLTISDIKEEACREAEIYYNAGLDGLIIENM
HDIPYTLDVGPEVCACMTAVCTAVRGLYPSWPLGVQILSAANHSALAVALASGLDFIRAE
GFVFSHVADEGLLNACAGELLRYRKRIGAEHVQIFTDIKKKHSAHALTADVSIAETAQAA
EFFLSDGVVVTGSATGAKADPQELREVSQSVRIPVLIGSGVTDDNVEHYLQASAMIIGSH
FKKGGYWANGVDAERVKRFMGKMHKLRE
Download sequence
Identical sequences A0A0R4ISR8
ENSDARP00000089698 7955.ENSDARP00000089698 ENSDARP00000089698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]