SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000093977 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000093977
Domain Number 1 Region: 333-600
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 5.3e-115
Family N-acetyl transferase, NAT 0.0000000192
Further Details:      
 
Domain Number 2 Region: 179-219
Classification Level Classification E-value
Superfamily CCHHC domain 0.0000000000000379
Family CCHHC domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000093977   Gene: ENSDARG00000070371   Transcript: ENSDART00000103201
Sequence length 606
Comment pep:known_by_projection chromosome:Zv9:3:33026269:33038926:-1 gene:ENSDARG00000070371 transcript:ENSDART00000103201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRRKRNAGSSSEGTEDSDFSAEHTDSSESEAHVVRNTRLTRSSLRLSRSSQDASPVRNP
TAPVSEEVVNYSTRRVTRSQQQGATVSPKKYPLRQSRSSGSDTEQHGEISERDIKQSADH
DESPPRTPTGNAASSESDIDMSSPNVSHDESLAKELSLKESSLAHRPKRRRFHESYNFNM
KCPTPGCNSLGHLTGKHERHFSISGCPLYHNLSADECKVKVSSRDKHVEERTLSQRQDEN
RHSARQQAQTERQLRYKEKVTEMRRKRNSVPPKEQKDKFTEHRQTHSSSREPLLENITSD
YDLELFRKAQARASDDLEKLRLQGQVTEGGNMIKTIVFGRYELDTWYHSPYPEEYARLGR
LYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIYRKGVISVFEVDGKKNKIYCQNLCLL
AKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLVGYFSKEKNSFLNYNVSCILTMPQYMRQ
GYGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSYWKEVLLRYLHNFQGKEISIKEI
SQETAVNPVDIVSTLQSLQMLKYWKGKHLILKRQDLIDDWKTKEAKRGSNKTIDPTSLKW
SPPKGT
Download sequence
Identical sequences E7FAT9
ENSDARP00000093977 ENSDARP00000123679 ENSDARP00000093977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]