SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000095601 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000095601
Domain Number 1 Region: 1-153
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 4.32e-29
Family N-acetyl transferase, NAT 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000095601   Gene: ENSDARG00000071060   Transcript: ENSDART00000104831
Sequence length 224
Comment pep:known chromosome:Zv9:23:13944337:13952423:-1 gene:ENSDARG00000071060 transcript:ENSDART00000104831 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKM
EEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALH
LYSNTLKFQISEVEPKYYADGEDAYAMKRNLTQMADELQKPGVRLWGSEAPPSQDTSVTG
LVEKLTVQDGEKEGDGDSGGESKEMSEVSEATESTDVKDSSSDS
Download sequence
Identical sequences Q7T3B8
ENSDARP00000095601 ENSDARP00000095601 7955.ENSDARP00000095595 7955.ENSDARP00000095601 NP_998499.1.45394 XP_018962492.1.5815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]