SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000097546 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000097546
Domain Number 1 Region: 6-34,85-205
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 7.92e-22
Family N-acetyl transferase, NAT 0.0045
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000097546
Domain Number - Region: 34-74
Classification Level Classification E-value
Superfamily Cytochrome c oxidase subunit I-like 0.0785
Family Cytochrome c oxidase subunit I-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000097546   Gene: ENSDARG00000077028   Transcript: ENSDART00000108786
Sequence length 229
Comment pep:putative chromosome:Zv9:6:55725870:55737970:-1 gene:ENSDARG00000077028 transcript:ENSDART00000108786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKLNMHIVIRHYQPSDREAVETVFREAIEEHINPAFMYAMTRPLHITISLFIYVSAYIL
STYSLVLSLMCGGSWIGLVYFCCHEFYAGYVRSRLNTDMKDISAYYLENPDNCFWVAEAE
IEGRPQVLGMVAVEGKKGSEKYGELYRMIVSSACRRTGLGVKLAQTAEDFCRERGFSKIM
LSTSSTQKAAVALYFKLGFKLLRVHTQTESMQWMIWMTRATILTMEKKI
Download sequence
Identical sequences E7F6N3
XP_001343904.2.45394 ENSDARP00000097546 ENSDARP00000097546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]