SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000099461 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000099461
Domain Number 1 Region: 47-340
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.9e-109
Family alpha-D-glucuronidase/Hyaluronidase catalytic domain 0.00000681
Further Details:      
 
Domain Number 2 Region: 708-907
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00000000266
Family N-acetyl transferase, NAT 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000099461   Gene: ENSDARG00000074686   Transcript: ENSDART00000111438
Sequence length 909
Comment pep:novel chromosome:Zv9:13:11742835:11759423:-1 gene:ENSDARG00000074686 transcript:ENSDART00000111438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQKDKIIESSQPEVEVIPVPVEAVADTQCPVDEPTIEIERTGRRKFITGVVEGFYGRPW
TMEQRKELFRRQQKWGLNTYLYAPKDDYKHRMFWREMYSVEEAEQLTTLISAAKEYGIEF
IYAISPGLDITFSNQKEVSTLKRKLDQVTHFGCKSFALLFDDIDHNMCPADKEVFSSFAH
AQVSVTNEIFQYLGEPEIFLFCPTEYCGTFCYPNVSQSPYLRTIGEKLLPGIEVLWTGPK
VVSKDITVESIEEVTKILRRAPVIWDNIHANDYDQKRLFLGPYKGRSTELIPRLKGVLTN
PNCEFESNFVAIHTLATWYKSNMNGVRKDVVMTDSEDSTVSIQIKLENEGSDEELETDIL
YSPQIALKLALTEWLSEFGVPHQYNSRQVPHSGTKSTTMDVPTLAASTLVTSTTVTTVFQ
QPIMSPVLPLSDEPHVLGKEEEEEVEKKESDEEPMEMVVEKHDEVEDTKNVNQILTEIVK
AKMTEDLKPMDTDKESLTESKSPEMSIQEDSGSDIAPMQTDDQLNKEVFVPGPNEKPLFI
TEALTLEDLTLLAELFYLPYEHGPKSVQMLKEFNWLRANSNYVSVNSKAKDPEKVTEWQS
RAENFEEMCCSVMQMFTRLSNSANRTILYDLYPYIWDIKSIISMVKSFVQWLGCRSQSSA
QFLSGDQEPWAFRGGLAGEFQRLLPIDGANDLFYQPPPSMPTSKIYTIRPYFAKDESAIY
KICKEMFTESCEGISFSDESPDLIGDRLVGGFLTLSPDYGFVLEDEEGVCGYAMGTVDVK
PFVKKCKLSWIPFMQEKYIKPDAEKDLSEAEKMMLSFHEEEDGLPESFLRNFPSLIKVDI
HAKVTDPSVAKSMMGCLLSSLKANGSHGAFCEVRQIDKRMLDFYSKLGCFEVAKMEGFPK
DIIIMGRSL
Download sequence
Identical sequences E7F547
ENSDARP00000099461 ENSDARP00000099461 NP_001292485.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]