SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000108895 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000108895
Domain Number 1 Region: 143-219
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00000291
Family N-acetyl transferase, NAT 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000108895   Gene: ENSDARG00000088414   Transcript: ENSDART00000127375
Sequence length 219
Comment pep:known scaffold:Zv9:Zv9_NA48:15558:87808:1 gene:ENSDARG00000088414 transcript:ENSDART00000127375 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKGADPSRPPCRKAKDIRKERRLQKDQQMQQEAVSSSPNPTPSKSSSSNQPKSLEEFITE
SLPNDPLHRLEVRLVRSNPPSPQFKASFDASYQVYKLYQMAIHEDPPDKPSESQFKRFLC
DSPLEAETAPDGPDVGYGSFHQQYWLDGRIVAVGVLDILPSCVSSVYLYYHPDFSSLSLG
TYSALREIAFTRQLQQQSPKLAYYYLGFYVHSCPKMRYK
Download sequence
Identical sequences H9GYT6
ENSDARP00000108895 ENSDARP00000108895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]