SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000108929 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000108929
Domain Number 1 Region: 7-117
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00000000000408
Family N-acetyl transferase, NAT 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000108929   Gene: ENSDARG00000086222   Transcript: ENSDART00000129834
Sequence length 335
Comment pep:known_by_projection chromosome:Zv9:7:27264108:27273776:1 gene:ENSDARG00000086222 transcript:ENSDART00000129834 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIENSLPCSQLPEAPPQTGLQFTVATEEDFDDIMAMSKDIYGGLDYLPSRYQAWLQESN
RTVILARKQGKVIALESVCVIDDGETMLVEGLRVAPQERGKGVAGVLLRFCSQLVKSKYP
DVKVSRLTRDDQLGPKDFQKYRLITKQGILLVRFRAEDLKLRLGDLGPNISVAGEALSTA
NIPVCLEPAEVHQLFLSDVLMQDVLPNATIVQDWQPFKPLPSNMAILMKKDIDWMVDDAK
RPTMTSLCTFPFHVPIGDDWYYLNIDMFGKNLTLAIQQLLCHLRRHTGTLKGYVMCQVFM
EPALWKPMAEFFRETLKVELVKEYTEQCVVESDVI
Download sequence
Identical sequences E7FET0
ENSDARP00000108929 XP_001342856.1.45394 ENSDARP00000108929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]