SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000110508 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDARP00000110508
Domain Number - Region: 143-209
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0101
Family N-acetyl transferase, NAT 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000110508   Gene: ENSDARG00000004177   Transcript: ENSDART00000122015
Sequence length 508
Comment pep:novel chromosome:Zv9:21:14073820:14101757:1 gene:ENSDARG00000004177 transcript:ENSDART00000122015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFPVDVLVSGRHEDLESSAQSYMNKLLYSNPDNAEYLTLSNTRKIRISPANVGFVPLYG
ANLKHKVLALFAPEDQFTAVALFLVDQWYTVEDLLRTSNPAREGLVKVRSVGERIVLYVL
NRIIYRTMEMGTNEVPFLCHEEDVFAKILWKNGEAVGFYSVKCKGSLCNSFVSQCYLLPV
MDSIFVRKSQRSNGHGLQMLEDFVDSFKDDELGLKYPLTTAMQRVCSQYLRRYPADVDLL
WEVEGVGGPYQKVKIATKLGSMILQCNHSSWAAEESKNGEVNEVEMTEESLDITEEVVVV
KHRKVAEEINDLPISTRTRSSEHKHKKRPREEPEEIAGENRPEKINRLVEPEAETDPDAV
PETKEHTDGESGEQGQEVEKNSLQEEFVVTSVASVAETEILVAEVNGEMSESHEDENERS
ANAEDEPVNQELPLEAEAAIQNGADEEMEADRDAQDDIINTPDESVEAVEQMDQERVTEE
RQEAEAEVSPLVEDEGELEQKREEEAVS
Download sequence
Identical sequences E7F8M9
ENSDARP00000110508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]