SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000110578 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000110578
Domain Number 1 Region: 342-470
Classification Level Classification E-value
Superfamily Plus3-like 2.09e-46
Family Plus3 0.000000378
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000110578   Gene: ENSDARG00000008947   Transcript: ENSDART00000130127
Sequence length 701
Comment pep:known chromosome:Zv9:13:33453048:33469756:-1 gene:ENSDARG00000008947 transcript:ENSDART00000130127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XWRSAALLFKHTHRGARQLTMVNVKKRKGRVVIDSDSEDSASDDNLDQELLSLAKRKRVD
SDEQEEPVSKPAASTDSETSDSDDEWTVGGTKTKKKGKPSKGPEKKNTVKKRKGKAASSG
SSNGDSSGESSAPEEGEVSDSDSNSSSSSSDSDSSSEDEVFRDGYGDDLMGDEEDRARLE
QMTEKEREQELFNRIEKREVLKRRFEIKQKLKTAKKKEKEEKKKKQEEEQEKRKQSQVPD
TQVVMSHNKERRIKRDEKLDKKSQAMEELKAEREKRKNRTAELLAKRQPLKTSEVYSDDE
EEEEDDDDKSSVKSDRSSRSSSFDEEEEKEEAPPKSQPVSLPDELNRIRLSRHKLERWCH
MPFFAKTVTGCFVRIGIGNSSNKPVYRVAEIIDVVETAKIYQLGSTRTNKGLQLRHGNDT
RVFRLEFVSNQEFTESEFMKWKEAMMIAGMQLPTLDEINKKEQSIKEAVNYKFNDKDIED
IVKEKDRFRKAPPNYAMKKTQLLKEKAMAEESGDGDKAKTLQDQLNELEERAEALDRQRT
KNISAISYINQRNRSWNIVESEKALVAEGQNSKNQQMDPFTRRQCKPTMVSNARDPSVHA
AILAHLNQKYGSGSGAGQDNSQQANKQLGQASQKDKDVTKPTSDLSEDLFKVHDFDVKID
LQVPNAEAKSLSVSSNALPVKDGAPRRSLNLEDYKKRRGLI
Download sequence
Identical sequences G1K2X4
ENSDARP00000110578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]