SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000111083 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000111083
Domain Number 1 Region: 52-181
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.7e-51
Family Calponin-homology domain, CH-domain 0.000000307
Further Details:      
 
Domain Number 2 Region: 253-313
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 1.96e-19
Family EB1 dimerisation domain-like 0.0000532
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000111083   Gene: ENSDARG00000002659   Transcript: ENSDART00000129167
Sequence length 325
Comment pep:known chromosome:Zv9:23:9901568:9914536:-1 gene:ENSDARG00000002659 transcript:ENSDART00000129167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSISNDQERLLICHICFAQYVPCVALRDDVKQPKNKPTHDLRERGAGEQEDMAVNVYSTS
VTSDNLSRHDMLAWINESLQMNFTKIELLCSGAAYCQFMDMLFPGCIPLKKVKFGAKLEH
EYIHNFKILQAAFKKMGVDKIIPVDKLVKGKFQDNFEYVQWFKKFFDANYDGKEYDPVEA
RQGQDTMPVPNPSMSALSKPKKIMNAVHQPPPVRTTKPAVEIAPQRAAVAKVTPKMVPGS
ARRPGAGGDEERAELIQELNILKSTIQDMEKERDFYFGKLRNIELICQEKEGEGDPTLQR
IVDILYATDEGFVIPDAESEDQEEF
Download sequence
Identical sequences ENSDARP00000111083 ENSDARP00000111083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]