SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000113821 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000113821
Domain Number 1 Region: 26-152
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.17e-38
Family Ornithine decarboxylase antizyme-like 0.000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000113821   Gene: ENSDARG00000071403   Transcript: ENSDART00000139341
Sequence length 159
Comment pep:known chromosome:Zv9:22:21034970:21036339:-1 gene:ENSDARG00000071403 transcript:ENSDART00000139341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVPLPPLKIPGGRGNDQRDHSLSAKLFYSDAQLLVLEEAPQSNSRVRFLLFERRCSVSKH
LVWRGALKGTNLYIEIPTGVLPEGSKDSFSLLLEFAEEKLQVDHVFICFHKSRDDRASLL
RTFSFMGFEIVRPGHPLVPTRPDAFFMAYRIERDSDGDE
Download sequence
Identical sequences ENSDARP00000113821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]