SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000114601 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000114601
Domain Number 1 Region: 3-153
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.53e-34
Family N-acetyl transferase, NAT 0.00000872
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000114601   Gene: ENSDARG00000035215   Transcript: ENSDART00000132548
Sequence length 171
Comment pep:known chromosome:Zv9:5:63582313:63622810:-1 gene:ENSDARG00000035215 transcript:ENSDART00000132548 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFTISAAKPEDCKDIERMIMELAVYENMPDQVKISHKELERDGFGPNPFYHCLVAEVPE
EHKSKDGNTTVGYVIFFYTYSTWKGRTVYMEDLYVMPEFRGNGIGKALLGAVAKEAKDQL
CSRLQFSVLDWNKPSLYFYMAKGAEDLTAKEGWHFLRFHGMALDNLAQEAP
Download sequence
Identical sequences A0A0R4IHX8
ENSDARP00000114601 7955.ENSDARP00000051013 XP_005165549.1.45394 ENSDARP00000114601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]